er583 er583
  • 10-10-2020
  • Mathematics
contestada

What is the missing length of this rectangle?

What is the missing length of this rectangle class=

Respuesta :

kren1115
kren1115 kren1115
  • 10-10-2020

Answer:

Answer is 11. You have to add the 4 and 7.

Answer Link
shanelzheng240
shanelzheng240 shanelzheng240
  • 10-10-2020

In rectangles all sides are either perpendicular or parallel, so you know that the missing side is equal to the bottom 2 horizontal sides added up.

4 + 7 = 11.

The missing side is 11cm.

Answer Link

Otras preguntas

What are three of the hustles Malcolm had in Harlem?
Name any 2 physical quantities which have same dimensions.Can a quantity have unit but no dimensions?Explain​
Martin bikes at a constant speed to a finish line that is 15 mi away. After 20 mins, he is 10 mi from the finish line. After 30 mins, he is 7.5 mi from the fini
The oligopeptide MNQSYGRLVSRAAIAATAMASLIKIFAWWY was cleaved by reaction with trypsin. Trypsin is a serine protease that hydrolyses peptide chains at the protein
why does Telemachus think that Odysseus is God? how does Odysseus explain his sudden transformation​
x/7+x-2/14=1/7 Please answer x as a fraction!
Was the League of Nations successful with ending child labor?
Draw a linear scale showing 1cm on the map corresponding to 500km on the ground ​
36 In the given circuit, A, B, C and D are four lamps connected with a battery of 60V.Analyse the circuit to answer the following questions.(i) What kind of com
explain the development process of education in nepal ​